• Home
  • Shop My Instagram
  • Shop My Amazon Page
  • Beauty
    • All Things Makeup
    • All Things Hair
    • All Things Nails
    • Amazon Macro Faves List
  • Fashion
  • GIFT GUIDES 2023
    • AMAZON GIFT GUIDE
    • GIFTS FOR HER
    • GIFTS FOR HIM
    • GIFTS FOR KIDS
    • GIFTS FOR THE HOSTESS
    • FOR THE TRAVELER
  • Home Decor
    • Amazon Home Finds with The Lillie Bag
  • Where I shop
  • About
  • Contact
  • Blog

The Lillie Bag

Currently Wearing, Fall Fashion, Walmart
/
August 12, 2020

Fall Fashion New Arrivals

Hi friends! I hope your week is off to a great start! I’m SO excited that fall is right around the corner because fall fashion is hands down my favorite! Give me all of the jackets and booties! Today I’m sharing my new arrivals from Walmart that are great and affordable for fall.

The new Sofia fall line dropped at Walmart last month and these items are GOOD. Fall is all about denim, bodysuits/tops, and lightweight outerwear. The best part, there is truly something for everyone. There are so many different pieces and they’re available in sizes 0-22 and XS-XXXL. Prices start at $19 and all denim is under $30! All of these pieces are such great quality as well. Can you even believe that!? These jeans are not only really affordable, but so dang cute and flattering!

A limited assortment is available in select Walmart stores but most items arrive in two days when you order online! Her items to tend to go quickly. This line is always very on trend and affordable with sizes for all body shapes.

How stinking cute are these booties and boots!? They are so perfect for fall and incredibly comfortable too! They have memory foam and are only $22!

Another great pair of denim and this pair is only $25! This was my favorite pair I got in and they fit true to size. These are the curvy high rise jeans and they are super comfy and flattering on! These rain boots are SO good. They remind me of some others you are seeing for a fraction of the price and the quality was spot on. How cute are they?

More favorites from Sofia:

Thank you to Walmart for sponsoring this post. As always, all opinions are my own.

TAGS:fall fashionfall previewfall trendsfallfashionfallinspofalllookbookfallstylefalltrendswalmartwalmart fashionwalmart fashion findswalmart fashion trendswalmartfashion
0 Comments
Share

You May Also Like

August 2, 2017

What’s Left of The Nordstrom Sale : Favorties

September 9, 2020

Fall Drugstore Beauty Finds

June 3, 2024

Amazon Summer Finds

Leave a Comment Cancel Comment

This site uses Akismet to reduce spam. Learn how your comment data is processed.

Previous Post
Nordstrom Anniversary Sale 2020
Next Post
Best in Sale – Nordstrom Anniversary Sale 2020
Hi, I’m Lauren

Hi, I’m Lauren

Lauren

I'm a Mom, Hair Stylist, and Wife who loves styling the layers of life! From my style to yours and all affordable things in between, I'm so glad you're here with me! Always comfy, sometimes cute, and will work for wine! Cheers to my take on "Styling the Layers of Life!"

Follow on Instagram

  • the pants I keep reaching for🔥... they’re amazing.
Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️

CommenT: PANTS for a DM to shop today’s look or head to my bio!

Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
  • Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
  • Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
  • Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
@thelilliebag
@thelilliebag
•
Follow
the pants I keep reaching for🔥... they’re amazing. Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️ CommenT: PANTS for a DM to shop today’s look or head to my bio! Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
3 days ago
View on Instagram |
1/4
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
@thelilliebag
@thelilliebag
•
Follow
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! CommenT: NOSY for a DM to shop or head to my bio! -must be following for message to send♥️ Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅 Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
4 days ago
View on Instagram |
2/4
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
@thelilliebag
@thelilliebag
•
Follow
Things that have me excited for spring lately ☁️🤍 CommenT: SPRING and I’ll send you all the links via DM + recipe✨ Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! Just sharing a few little things making everyday life feel good again lately! 🌸🤍 High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
6 days ago
View on Instagram |
3/4
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
@thelilliebag
@thelilliebag
•
Follow
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
1 week ago
View on Instagram |
4/4

Beauty

Home

Gift Guides

Categories

Latest Products

let's shop

Latest Video

Latest Video Latest Video

15 Minute Men’s Haircut

Subscribe to My Channel

Where I Shop

the faves

Abercrombie

Amazon

American Eagle

Evereve

Nordstrom

Nordstrom Rack

Sephora

Target

Walmart

Recent Posts

  • Worth the Hype: The Pieces Everyone’s Buying

    February 19, 2026
  • Stuff Worth Buying: Bougie or Budget Edition

    February 5, 2026
  • What I’m Loving + Wearing Lately

    January 22, 2026
the pants I keep reaching for🔥... they’re amazing.
Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️

CommenT: PANTS for a DM to shop today’s look or head to my bio!

Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
•
Follow
the pants I keep reaching for🔥... they’re amazing. Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️ CommenT: PANTS for a DM to shop today’s look or head to my bio! Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
3 days ago
View on Instagram |
1/6
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! CommenT: NOSY for a DM to shop or head to my bio! -must be following for message to send♥️ Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅 Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
•
Follow
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! CommenT: NOSY for a DM to shop or head to my bio! -must be following for message to send♥️ Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅 Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
4 days ago
View on Instagram |
2/6
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
•
Follow
Things that have me excited for spring lately ☁️🤍 CommenT: SPRING and I’ll send you all the links via DM + recipe✨ Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! Just sharing a few little things making everyday life feel good again lately! 🌸🤍 High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
6 days ago
View on Instagram |
3/6
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
•
Follow
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
1 week ago
View on Instagram |
4/6
had to share this bag😍! Fun little surprise + what I’m actually  wearing to lunch today! 
CommenT: MAY for a DM to shop or head to my bio! 

Love these pants so much! Can wear to work too! Have a great day! Off to celebrate with some lunch and champs🥂🎂 & the sun came out! Thank you, Mom🥹🪽☀️! Miss you big today and always! She always made birthdays so special. 

Spring pants, ootd, track pants, ysl, designer bag, review, gifts for her, luxe gifts, women’s fashion, style over 40, weekend, lunch, Chicago, spring 2026, workwear, resort wear, sports mom, casual outfit, spring fashion, spring tops, raffia
•
Follow
had to share this bag😍! Fun little surprise + what I’m actually wearing to lunch today! CommenT: MAY for a DM to shop or head to my bio! Love these pants so much! Can wear to work too! Have a great day! Off to celebrate with some lunch and champs🥂🎂 & the sun came out! Thank you, Mom🥹🪽☀️! Miss you big today and always! She always made birthdays so special. Spring pants, ootd, track pants, ysl, designer bag, review, gifts for her, luxe gifts, women’s fashion, style over 40, weekend, lunch, Chicago, spring 2026, workwear, resort wear, sports mom, casual outfit, spring fashion, spring tops, raffia
1 week ago
View on Instagram |
5/6
sweatpants or jeans👀? You know my answer✔️😅! The jacket we all love so much has matching pants! Yes- sweatpants that look like denim but not all styles I like! These are the ones you want!
CommenT: JEANS for a DM to shop or head to my bio! 

Ladies I love these! Jacket is a most loved in this space and these pants didn’t disappoint! TTS 🤍

spring pants, weekend, spring style, jeans, denim, sandals, style over 40, casual outfit, Chicago, volleyball, women’s fashion, outfit idea, spring outfits, style inspo, spring 2026,
•
Follow
sweatpants or jeans👀? You know my answer✔️😅! The jacket we all love so much has matching pants! Yes- sweatpants that look like denim but not all styles I like! These are the ones you want! CommenT: JEANS for a DM to shop or head to my bio! Ladies I love these! Jacket is a most loved in this space and these pants didn’t disappoint! TTS 🤍 spring pants, weekend, spring style, jeans, denim, sandals, style over 40, casual outfit, Chicago, volleyball, women’s fashion, outfit idea, spring outfits, style inspo, spring 2026,
1 week ago
View on Instagram |
6/6
@thelilliebag
  • Home
  • About
  • Blog
  • Contact

Copyright © 2026 The Lillie Bag. All Rights Reserved.Site Powered by Pix & Hue.