• Home
  • Shop My Instagram
  • Shop My Amazon Page
  • Beauty
    • All Things Makeup
    • All Things Hair
    • All Things Nails
    • Amazon Macro Faves List
  • Fashion
  • GIFT GUIDES 2023
    • AMAZON GIFT GUIDE
    • GIFTS FOR HER
    • GIFTS FOR HIM
    • GIFTS FOR KIDS
    • GIFTS FOR THE HOSTESS
    • FOR THE TRAVELER
  • Home Decor
    • Amazon Home Finds with The Lillie Bag
  • Where I shop
  • About
  • Contact
  • Blog

The Lillie Bag

Uncategorized
/
April 3, 2017

Quick and Easy Pinterest Recipes // Six easy one pan recipes for the week ahead.

Ready for a new week to begin.  Lately I have been trying to find the quickest and easiest one pan or skillet meals for the family.  Trying to meal plan ahead for the week really helps make life a bit easier when it comes to dinner time!  Linking up some of my favorite recipes for you all to try!   Believe me, when I say easy,  I mean it.  Delicious and done all in one!

Change up your taco Tuesday and make it baked fajitas!  I like to make my own seasoning and keep it in a mason jar and this way you can just pull it out as needed!  This was a hit in our household and so easy.

Who doesn’t love a meatless meal that’s ready in 20 minutes?  This also makes a great appetizer or side for any main dish!  You can really spice this up and make it festive if needed as well.  Super easy.

For those of you who don’t already know, I am a chicken girl through and through.  Pretty much my go to, so anytime I can change it up or add some flavor all in one pan, I’m all over it!  These are great for hosting as well!  Prep ahead and just bake!

My husband really loves a good old pork chop from time to time!  Try this one out!  Really doesn’t get much easier than this!

Get those lists ready and try a few out! Tag a friend who loves a quick and easy meal as much as the next person!  Hope you enjoy a few of the above favorites here!  Tell me your favorite one pan meal!  Would love to try more!

~Lauren~

TAGS:bbloggerbloggingfundamentalschickenrecipeseasymealsfbbloggerlifestylebloggermealplanningmomlifeonepanmealspinterestmealsrecipes
0 Comments
Share

You May Also Like

July 11, 2023

Amazon Prime Day 2023

September 13, 2021

Dining Room Refresh for Fall

June 26, 2020

Fourth of July Must Haves

Leave a Comment Cancel Comment

This site uses Akismet to reduce spam. Learn how your comment data is processed.

Previous Post
Fashion Friday Add Ons
Next Post
What’s Trending? Raw Hem denim makes the cut! The Essentials.
Hi, I’m Lauren

Hi, I’m Lauren

Lauren

I'm a Mom, Hair Stylist, and Wife who loves styling the layers of life! From my style to yours and all affordable things in between, I'm so glad you're here with me! Always comfy, sometimes cute, and will work for wine! Cheers to my take on "Styling the Layers of Life!"

Follow on Instagram

  • the pants I keep reaching for🔥... they’re amazing.
Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️

CommenT: PANTS for a DM to shop today’s look or head to my bio!

Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
  • Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
  • Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
  • Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
@thelilliebag
@thelilliebag
•
Follow
the pants I keep reaching for🔥... they’re amazing. Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️ CommenT: PANTS for a DM to shop today’s look or head to my bio! Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
3 days ago
View on Instagram |
1/4
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
@thelilliebag
@thelilliebag
•
Follow
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! CommenT: NOSY for a DM to shop or head to my bio! -must be following for message to send♥️ Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅 Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
4 days ago
View on Instagram |
2/4
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
@thelilliebag
@thelilliebag
•
Follow
Things that have me excited for spring lately ☁️🤍 CommenT: SPRING and I’ll send you all the links via DM + recipe✨ Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! Just sharing a few little things making everyday life feel good again lately! 🌸🤍 High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
6 days ago
View on Instagram |
3/4
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
@thelilliebag
@thelilliebag
•
Follow
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
1 week ago
View on Instagram |
4/4

Beauty

Home

Gift Guides

Categories

Latest Products

let's shop

Latest Video

Latest Video Latest Video

15 Minute Men’s Haircut

Subscribe to My Channel

Where I Shop

the faves

Abercrombie

Amazon

American Eagle

Evereve

Nordstrom

Nordstrom Rack

Sephora

Target

Walmart

Recent Posts

  • Worth the Hype: The Pieces Everyone’s Buying

    February 19, 2026
  • Stuff Worth Buying: Bougie or Budget Edition

    February 5, 2026
  • What I’m Loving + Wearing Lately

    January 22, 2026
the pants I keep reaching for🔥... they’re amazing.
Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️

CommenT: PANTS for a DM to shop today’s look or head to my bio!

Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
•
Follow
the pants I keep reaching for🔥... they’re amazing. Literally business in the front & party in back if you know what I mean- traveling in mine & work friendly! 🤏🏼✔️ CommenT: PANTS for a DM to shop today’s look or head to my bio! Spring pants, spring outrits, workwear, denim, sneakers, casual, outfits, travel, resort wear, sports mom, weekend, style over 40, necklace, women’s fashion, track pants, Chicago,
3 days ago
View on Instagram |
1/6
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! CommenT: NOSY for a DM to shop or head to my bio! -must be following for message to send♥️ Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅 Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! 
CommenT: NOSY for a DM to shop or head to my bio! 
-must be following for message to send♥️

Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅

Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
•
Follow
Because we’re all a little nosy 👀 here’s what my analytics are actually saying you’re buying lately… including a few controversial ones! CommenT: NOSY for a DM to shop or head to my bio! -must be following for message to send♥️ Want to see more of these?! I think it’s fun to see behind the scenes what ppl buy regardless! 👀🤏🏼😅 Clocked it, best sellers, spring fashion, designer bag, Chicago, spring style, beauty finds, style over 40, women’s fashion, gifts, luxe, affordable, weekend, casual, loved, eat, ate
4 days ago
View on Instagram |
2/6
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
Things that have me excited for spring lately ☁️🤍

CommenT: SPRING and I’ll send you all the links via DM + recipe✨

Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! 

Just sharing a few little things making everyday life feel good again lately! 🌸🤍

High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
•
Follow
Things that have me excited for spring lately ☁️🤍 CommenT: SPRING and I’ll send you all the links via DM + recipe✨ Lived-in waves, neutral nails that go with everything, getting my steps in again, high-protein favorites that don’t taste “healthy,” spring accessories that completely change an outfit, and pieces I know I’ll actually wear on repeat! Just sharing a few little things making everyday life feel good again lately! 🌸🤍 High protein, spring fashion, style over 40, beauty hacks, skincare, spring makeup, wavy hair, waves, shoes, sneakers, spring style, track pants, weekend, Chicago, layers, sports mom, resort wear, shorts, sandals, white pants,
6 days ago
View on Instagram |
3/6
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
Warm at noon. Freezing by dinner. 😂
c0mment: CHICAGO for a DM to shop or head to my bio! 

Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍

spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
•
Follow
Warm at noon. Freezing by dinner. 😂 c0mment: CHICAGO for a DM to shop or head to my bio! Here’s what survived this week’s Midwest weather mood swings lol… lots of layers, repeat offenders, travel favorites, comfy heels that actually pass the test, and the pieces I keep reaching for over and over lately! 👀✔️😍 spring fashion, jeans, denim, weekend, sandals, style over 40, workwear, Chicago, women’s fashion, beauty musts, casual outfits, spring style, spring outfits, resort wear, spring dress, dress, designer, high and low, hair color,
1 week ago
View on Instagram |
4/6
had to share this bag😍! Fun little surprise + what I’m actually  wearing to lunch today! 
CommenT: MAY for a DM to shop or head to my bio! 

Love these pants so much! Can wear to work too! Have a great day! Off to celebrate with some lunch and champs🥂🎂 & the sun came out! Thank you, Mom🥹🪽☀️! Miss you big today and always! She always made birthdays so special. 

Spring pants, ootd, track pants, ysl, designer bag, review, gifts for her, luxe gifts, women’s fashion, style over 40, weekend, lunch, Chicago, spring 2026, workwear, resort wear, sports mom, casual outfit, spring fashion, spring tops, raffia
•
Follow
had to share this bag😍! Fun little surprise + what I’m actually wearing to lunch today! CommenT: MAY for a DM to shop or head to my bio! Love these pants so much! Can wear to work too! Have a great day! Off to celebrate with some lunch and champs🥂🎂 & the sun came out! Thank you, Mom🥹🪽☀️! Miss you big today and always! She always made birthdays so special. Spring pants, ootd, track pants, ysl, designer bag, review, gifts for her, luxe gifts, women’s fashion, style over 40, weekend, lunch, Chicago, spring 2026, workwear, resort wear, sports mom, casual outfit, spring fashion, spring tops, raffia
1 week ago
View on Instagram |
5/6
sweatpants or jeans👀? You know my answer✔️😅! The jacket we all love so much has matching pants! Yes- sweatpants that look like denim but not all styles I like! These are the ones you want!
CommenT: JEANS for a DM to shop or head to my bio! 

Ladies I love these! Jacket is a most loved in this space and these pants didn’t disappoint! TTS 🤍

spring pants, weekend, spring style, jeans, denim, sandals, style over 40, casual outfit, Chicago, volleyball, women’s fashion, outfit idea, spring outfits, style inspo, spring 2026,
•
Follow
sweatpants or jeans👀? You know my answer✔️😅! The jacket we all love so much has matching pants! Yes- sweatpants that look like denim but not all styles I like! These are the ones you want! CommenT: JEANS for a DM to shop or head to my bio! Ladies I love these! Jacket is a most loved in this space and these pants didn’t disappoint! TTS 🤍 spring pants, weekend, spring style, jeans, denim, sandals, style over 40, casual outfit, Chicago, volleyball, women’s fashion, outfit idea, spring outfits, style inspo, spring 2026,
1 week ago
View on Instagram |
6/6
@thelilliebag
  • Home
  • About
  • Blog
  • Contact

Copyright © 2026 The Lillie Bag. All Rights Reserved.Site Powered by Pix & Hue.